PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G004700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family S1Fa-like
Protein Properties Length: 90aa    MW: 9991.73 Da    PI: 10.04
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G004700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA1369e-432289370
                 S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                         v  veakG+nPGlivllvvggl+l+fl+gny+ly yaqk+lPP+kkkPvskkk+kre+lkqG+++PGe
  Manes.08G004700.1.p 22 VDDVEAKGFNPGLIVLLVVGGLVLTFLIGNYVLYLYAQKTLPPKKKKPVSKKKMKRERLKQGISAPGE 89
                         5689***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190131.0E-42289No hitNo description
PfamPF046891.8E-402589IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MEDDFEFADH SPPSFQNMRN VVDDVEAKGF NPGLIVLLVV GGLVLTFLIG NYVLYLYAQK  60
TLPPKKKKPV SKKKMKRERL KQGISAPGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525167.12e-39PREDICTED: DNA-binding protein S1FA
SwissprotQ423371e-17S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLB9SGP82e-39B9SGP8_RICCO; DNA-binding protein S1FA, putative
STRINGPOPTR_0016s08890.11e-32(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355